PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G13240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 855aa    MW: 93866.2 Da    PI: 5.488
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G13240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.71.9e-182987357
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     k  ++t+eq+e+Le++++++++ps ++r++L + +    +++ +q+kvWFqNrR ++k+
  OGLUM10G13240.1 29 KYVRYTPEQVEALERVYAECPKPSSSRRQQLLRDCpilaNIEPKQIKVWFQNRRCRDKQ 87
                     5678****************************************************996 PP

2START149.23.7e-471673892204
                      HHHHHHHHHHHHHHHC-TT-EEEE...............EXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEE CS
            START   2 laeeaaqelvkkalaeepgWvkss...............esengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakae 80 
                      +aee+++e+++ka+ ++  Wv ++               ++++g+++  +++ s++++g a+ra+g+v  ++++ ve+l d++  W +++++ e
  OGLUM10G13240.1 167 IAEETLTEFLSKATGTAVDWVPMPgmkvdcqllrftlpaSNDPGPDSFGIVAVSHGCRGVAARACGLVNLEPTKIVEILKDRP-SWFRDCRSLE 259
                      7899*********************************************************************9999999999.********** PP

                      EEEEECTT..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
            START  81 tlevissg..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwve 168
                      +      g  g+++l +++++a+++lvp Rdf+++Ry+ ++++g++v++++S++     p+    +++vRae+lpSg+l++p+++g+s v++v+
  OGLUM10G13240.1 260 VFTMFPAGngGTIELVYMQMYAPTTLVPaRDFWTLRYTTTMEDGSLVVCERSLSGSGGGPStasAQQFVRAEMLPSGYLVRPCEGGGSIVHIVD 353
                      *999999999********************************************9999998888899*************************** PP

                      -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
            START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                      h dl++++++++lr+l++s+++ ++k+++a+l++ +
  OGLUM10G13240.1 354 HLDLEAWSVPEVLRPLYESSRVVAQKMTTAALRHIR 389
                      ********************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-18984IPR009057Homeodomain-like
PROSITE profilePS5007115.4352488IPR001356Homeobox domain
SMARTSM003891.1E-152692IPR001356Homeobox domain
SuperFamilySSF466894.15E-162892IPR009057Homeodomain-like
CDDcd000863.71E-162989No hitNo description
PfamPF000465.0E-163087IPR001356Homeobox domain
CDDcd146861.94E-681120No hitNo description
Gene3DG3DSA:1.20.5.1704.6E-485135No hitNo description
PROSITE profilePS5084826.294157400IPR002913START domain
CDDcd088754.84E-71161392No hitNo description
Gene3DG3DSA:3.30.530.201.3E-21166367IPR023393START-like domain
SMARTSM002344.7E-31166391IPR002913START domain
SuperFamilySSF559617.83E-33167393No hitNo description
PfamPF018521.0E-44167389IPR002913START domain
PfamPF086704.2E-49712854IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009855Biological Processdetermination of bilateral symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010014Biological Processmeristem initiation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 855 aa     Download sequence    Send to blast
MAAAVAMRSG SGSDGGGGGY DKAGMDSGKY VRYTPEQVEA LERVYAECPK PSSSRRQQLL  60
RDCPILANIE PKQIKVWFQN RRCRDKQRKE ASRLQAVNRK LTAMNKLLME ENERLQKQVS  120
QLVHENAYMK QQLQNPSLGN DTSCESNVTT PQNPLRDASN PSGLLTIAEE TLTEFLSKAT  180
GTAVDWVPMP GMKVDCQLLR FTLPASNDPG PDSFGIVAVS HGCRGVAARA CGLVNLEPTK  240
IVEILKDRPS WFRDCRSLEV FTMFPAGNGG TIELVYMQMY APTTLVPARD FWTLRYTTTM  300
EDGSLVVCER SLSGSGGGPS TASAQQFVRA EMLPSGYLVR PCEGGGSIVH IVDHLDLEAW  360
SVPEVLRPLY ESSRVVAQKM TTAALRHIRQ IAQETSGEVV YALGRQPAVL RTFSQRLSRG  420
FNDAISGFND DGWSVMGGDG IEDVIIACNA KKVRNTSTSA NAFVTPGGVI CAKASMLLQS  480
VPPAVLVRFL REHRSEWADY NFDAYSASSL KTSSCSLPGL RPMRFSGSQI IMPLAHTVEN  540
EEILEVVRLE GQALTHDDGL MSRDIHLLQL CTGIDEKSMG SCFQLVFAPI DELFPDDAPL  600
ISSGFRVIPL DMKTDGTPAG RTLDLASSLE VGSTAQPTGD ASMDDCNLRS VLTIAFQFPY  660
EMHLQDSVAT MARQYVRSIV SSVQRVSMAI SPSRSGLNAG QKIISGFPEA PTLARWICQS  720
YQFHLGVELL RQADDAGEAL LKMLWDYEDA ILCCSFKEKP VFTFANEMGL NMLETSLVAL  780
QDLSLDKIFD EAGRKALYNE IPKLMEQGYV YLPGGVCLSG MGRHVSFEQA VAWKVLGEDN  840
NVHCLAFCFV NWSFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1028300.0AK102830.1 Oryza sativa Japonica Group cDNA clone:J033109G06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614901.10.0PREDICTED: homeobox-leucine zipper protein HOX9
SwissprotA2Z8L40.0HOX9_ORYSI; Homeobox-leucine zipper protein HOX9
TrEMBLA0A0E0BBT00.0A0A0E0BBT0_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0IU350.0A0A0E0IU35_ORYNI; Uncharacterized protein
STRINGORGLA10G0115700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60690.10.0HD-ZIP family protein